# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Initialising the parameters using config directory /augustus/config/ ... # Using protein profile unknown # --[26..335]--> unknown_B (9) <--[5..14]--> unknown_C (27) <--[2..23]--> unknown_D (28) <--[9..20]--> unknown_F (22) <--[0..17]--> unknown_G (27) <--[0..13]--> unknown_H (27) <--[0..230]-- # BUSCO_20180911_busco_2432604931 version. Using default transition matrix. # admissible start codons and their probabilities: ATG(1), CTG(0), TTG(0) # Looks like ./tmp/Contig20370720180911_busco_2432604931_.temp is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 1595, name = Contig203707) ----- # # Constraints/Hints: # (none) # Predicted genes for sequence number 1 on both strands # start gene g1 Contig203707 AUGUSTUS gene 1 447 0.96 + . g1 Contig203707 AUGUSTUS transcript 1 447 0.96 + . g1.t1 Contig203707 AUGUSTUS CDS 1 447 0.96 + 0 transcript_id "g1.t1"; gene_id "g1"; Contig203707 AUGUSTUS stop_codon 445 447 . + 0 transcript_id "g1.t1"; gene_id "g1"; # coding sequence = [gagtaccgatcaacccctctgaatctagggtactcgccggcacagttactgatgggccgcaagctaagatctatcctac # cagtaatgccagacgagctgaaaccaaagatgccgacccgggttcgagaaactatgaaaacagagagagaaaaacagaaagaatactatgaccgcagt # gacaagacctcttataacactttcagtaggagacagcataaagataccaagatggaaatgtggaacaaggtagtagttaccacagagggagtaacaga # tcatagcagtgtcaaaagcaagaaggagccccacattacaacaaaagacgaacacctaatccagacaggggaaacattgaagcagcatgtttcagaac # taccactacaaaaccgcatgcccacaccactcagcctaatcattctcagaaacccgtctgagagtcaattctga] # protein sequence = [EYRSTPLNLGYSPAQLLMGRKLRSILPVMPDELKPKMPTRVRETMKTEREKQKEYYDRSDKTSYNTFSRRQHKDTKME # MWNKVVVTTEGVTDHSSVKSKKEPHITTKDEHLIQTGETLKQHVSELPLQNRMPTPLSLIILRNPSESQF] # end gene g1 ### # command line: # /augustus/bin/augustus --codingseq=1 --proteinprofile=eukaryota_odb9/prfl/EOG09370V9R.prfl --predictionStart=0 --predictionEnd=21594 --species=BUSCO_20180911_busco_2432604931 ./tmp/Contig20370720180911_busco_2432604931_.temp