# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters using config directory /augustus/config/ ...
# Using protein profile unknown
# --[0..44]--> unknown_A (26) <--[0..33]--> unknown_B (33) <--[0..2]--> unknown_C (26) <--[0..4]--> unknown_D (15) <--[0..1]--> unknown_E (12) <--[0..4]--> unknown_F (17) <--[0..42]--> unknown_G (46) <--[0..25]--> unknown_H (21) <--[0..15]--> unknown_I (45) <--[4..122]--> unknown_J (10) <--[0..2]--> unknown_K (26) <--[0..152]--
# BUSCO_20180911_busco_2432604931 version. Using default transition matrix.
# admissible start codons and their probabilities: ATG(1), CTG(0), TTG(0)
# Looks like ./tmp/Contig10491620180911_busco_2432604931_.temp is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 1606, name = Contig104916) -----
#
# Constraints/Hints:
# (none)
# Predicted genes for sequence number 1 on both strands
# start gene g1
Contig104916	AUGUSTUS	gene	30	1606	0.56	-	.	g1
Contig104916	AUGUSTUS	transcript	30	1606	0.56	-	.	g1.t1
Contig104916	AUGUSTUS	stop_codon	30	32	.	-	0	transcript_id "g1.t1"; gene_id "g1";
Contig104916	AUGUSTUS	intron	165	731	0.67	-	.	transcript_id "g1.t1"; gene_id "g1";
Contig104916	AUGUSTUS	intron	851	1606	0.86	-	.	transcript_id "g1.t1"; gene_id "g1";
Contig104916	AUGUSTUS	CDS	30	164	0.73	-	0	transcript_id "g1.t1"; gene_id "g1";
Contig104916	AUGUSTUS	CDS	732	850	0.84	-	2	transcript_id "g1.t1"; gene_id "g1";
# coding sequence = [attccactgtgctggcatacgttctgaaggtactgaatcagagatacgactacggcgttaacctggtcctgttatccgt
# ggacgaggggatcaccggatacagggacgactcattagagacggtgaagagaaaccagcagcagtacgatttgccattaaagatcgtctcgtatgagg
# agctgtatggatggacaatggatgcgatcgttcgacagattggactgaaaaataactgtaggttactaaatccataa]
# protein sequence = [STVLAYVLKVLNQRYDYGVNLVLLSVDEGITGYRDDSLETVKRNQQQYDLPLKIVSYEELYGWTMDAIVRQIGLKNNC
# RLLNP]
# end gene g1
###
# command line:
# /augustus/bin/augustus --codingseq=1 --proteinprofile=eukaryota_odb9/prfl/EOG09370I7R.prfl --predictionStart=0  --predictionEnd=20851  --species=BUSCO_20180911_busco_2432604931 ./tmp/Contig10491620180911_busco_2432604931_.temp