# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008), # Using native and syntenically mapped cDNA alignments to improve de novo gene finding # Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013 # No extrinsic information on sequences given. # Initialising the parameters using config directory /augustus/config/ ... # Using protein profile unknown # --[0..663]--> unknown_A (19) <--[1..46]--> unknown_B (38) <--[1..9]--> unknown_C (15) <--[0..24]--> unknown_D (11) <--[0..6]--> unknown_E (11) <--[10..17]--> unknown_F (19) <--[8..19]--> unknown_H (20) <--[1..3]--> unknown_I (18) <--[0..1]--> unknown_J (37) <--[15..40]--> unknown_M (13) <--[1..30]--> unknown_N (20) <--[10..39]--> unknown_O (27) <--[2..8]--> unknown_P (11) <--[8..32]--> unknown_Q (37) <--[11..39]--> unknown_S (20) <--[0..2]--> unknown_T (17) <--[0..32]-- # BUSCO_20180911_busco_2432604931 version. Using default transition matrix. # admissible start codons and their probabilities: ATG(1), CTG(0), TTG(0) # Looks like ./tmp/Contig10874220180911_busco_2432604931_.temp is in fasta format. # We have hints for 0 sequences and for 0 of the sequences in the input set. # # ----- prediction on sequence number 1 (length = 2212, name = Contig108742) ----- # # Constraints/Hints: # (none) # Predicted genes for sequence number 1 on both strands # start gene g1 Contig108742 AUGUSTUS gene 1 2212 0.17 + . g1 Contig108742 AUGUSTUS transcript 1 2212 0.17 + . g1.t1 Contig108742 AUGUSTUS intron 1 556 0.73 + . transcript_id "g1.t1"; gene_id "g1"; Contig108742 AUGUSTUS intron 653 1406 0.58 + . transcript_id "g1.t1"; gene_id "g1"; Contig108742 AUGUSTUS intron 1530 2212 0.25 + . transcript_id "g1.t1"; gene_id "g1"; Contig108742 AUGUSTUS CDS 557 652 0.58 + 0 transcript_id "g1.t1"; gene_id "g1"; Contig108742 AUGUSTUS CDS 1407 1529 0.37 + 0 transcript_id "g1.t1"; gene_id "g1"; # coding sequence = [ggccaccctgcagccaaagtggacattctcgaaaaattaccagtgcccttcggactcgtgaggtttggagttgcccccg # atcaccctgaagtcaagaatgtcattcatactttcaccaccactgccagaaacaagcggtgtacgttcatggggaacatggaagtcggtaaagacgtc # tctgtagaagatcttcagagagcctacacagccgtggtactg] # protein sequence = [GHPAAKVDILEKLPVPFGLVRFGVAPDHPEVKNVIHTFTTTARNKRCTFMGNMEVGKDVSVEDLQRAYTAVVL] # end gene g1 ### # command line: # /augustus/bin/augustus --codingseq=1 --proteinprofile=eukaryota_odb9/prfl/EOG09370DP4.prfl --predictionStart=0 --predictionEnd=20700 --species=BUSCO_20180911_busco_2432604931 ./tmp/Contig10874220180911_busco_2432604931_.temp